Reaction Details |
| Report a problem with these data |
Target | Cathepsin Z |
---|
Ligand | BDBM50255753 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_462253 (CHEMBL945087) |
---|
IC50 | >10±n/a nM |
---|
Citation | Gauthier, JY; Chauret, N; Cromlish, W; Desmarais, S; Duong, le T; Falgueyret, JP; Kimmel, DB; Lamontagne, S; Léger, S; LeRiche, T; Li, CS; Massé, F; McKay, DJ; Nicoll-Griffith, DA; Oballa, RM; Palmer, JT; Percival, MD; Riendeau, D; Robichaud, J; Rodan, GA; Rodan, SB; Seto, C; Thérien, M; Truong, VL; Venuti, MC; Wesolowski, G; Young, RN; Zamboni, R; Black, WC The discovery of odanacatib (MK-0822), a selective inhibitor of cathepsin K. Bioorg Med Chem Lett18:923-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin Z |
---|
Name: | Cathepsin Z |
Synonyms: | CATZ_HUMAN | CTSZ | Cathepsin P | Cathepsin X |
Type: | PROTEIN |
Mol. Mass.: | 33870.59 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_595889 |
Residue: | 303 |
Sequence: | MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPA
DLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV
QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECH
AIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN
HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGD
PIV
|
|
|
BDBM50255753 |
---|
n/a |
---|
Name | BDBM50255753 |
Synonyms: | CHEMBL481611 | MK-0822 | Odanacatib |
Type | Small organic molecule |
Emp. Form. | C25H27F4N3O3S |
Mol. Mass. | 525.559 |
SMILES | CC(C)(F)C[C@H](N[C@@H](c1ccc(cc1)-c1ccc(cc1)S(C)(=O)=O)C(F)(F)F)C(=O)NC1(CC1)C#N |r| |
Structure |
|