Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntermediate conductance calcium-activated potassium channel protein 4
LigandBDBM23786
Substrate/Competitorn/a
Meas. Tech.ChEMBL_463302
IC50 70±n/a nM
Citation McNaughton-Smith GABurns JFStocker JWRigdon GCCreech CArrington SShelton Tde Franceschi L Novel inhibitors of the Gardos channel for the treatment of sickle cell disease. J Med Chem 51:976-82 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Intermediate conductance calcium-activated potassium channel protein 4
Name:Intermediate conductance calcium-activated potassium channel protein 4
Synonyms:IK1 | IKCa1 | KCa4 | Putative Gardos channel | SK4
Type:PROTEIN
Mol. Mass.:47723.22
Organism:Homo sapiens (Human)
Description:ChEMBL_1361891
Residue:427
Sequence:
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23786
n/a
NameBDBM23786
Synonyms:Triphenylmethyl-containing compound, 15 | triphenylmethanamine
TypeSmall organic molecule
Emp. Form.C19H17N
Mol. Mass.259.345
SMILESNC(c1ccccc1)(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: