Reaction Details |
| Report a problem with these data |
Target | B1 bradykinin receptor |
---|
Ligand | BDBM50371644 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_463823 (CHEMBL948902) |
---|
Ki | 0.5±n/a nM |
---|
Citation | Feng, DM; DiPardo, RM; Wai, JM; Chang, RK; Di Marco, CN; Murphy, KL; Ransom, RW; Reiss, DR; Tang, C; Prueksaritanont, T; Pettibone, DJ; Bock, MG; Kuduk, SD A new class of bradykinin B1 receptor antagonists with high oral bioavailability and minimal PXR activity. Bioorg Med Chem Lett18:682-7 (2008) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
B1 bradykinin receptor |
---|
Name: | B1 bradykinin receptor |
Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
Type: | Enzyme |
Mol. Mass.: | 40508.87 |
Organism: | Homo sapiens (Human) |
Description: | P46663 |
Residue: | 353 |
Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
BDBM50371644 |
---|
n/a |
---|
Name | BDBM50371644 |
Synonyms: | CHEMBL404484 |
Type | Small organic molecule |
Emp. Form. | C24H21Cl2F3N4O5 |
Mol. Mass. | 573.349 |
SMILES | COc1cc(on1)C(=O)NC1(CC1)C(=O)N[C@H](C)c1ncc(cc1F)-c1cc(Cl)cc(Cl)c1OCC(F)F |
Structure |
|