Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50371647
Substrate/Competitorn/a
Meas. Tech.ChEMBL_463823
Ki 0.9±n/a nM
Citation Feng DMDiPardo RMWai JMChang RKDi Marco CNMurphy KLRansom RWReiss DRTang CPrueksaritanont TPettibone DJBock MGKuduk SD A new class of bradykinin B1 receptor antagonists with high oral bioavailability and minimal PXR activity. Bioorg Med Chem Lett 18:682-7 (2008) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50371647
n/a
NameBDBM50371647
Synonyms:CHEMBL404705
TypeSmall organic molecule
Emp. Form.C23H20Cl2F6N2O3
Mol. Mass.557.313
SMILESC[C@@H](NC(=O)C1(CC1)NC(=O)C(F)(F)F)c1ccc(cc1F)-c1cc(Cl)cc(Cl)c1OC(CF)CF
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: