| Reaction Details |
|---|
 | Report a problem with these data |
| Target | B1 bradykinin receptor |
|---|
| Ligand | BDBM50371655 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_463823 (CHEMBL948902) |
|---|
| Ki | 1.4±n/a nM |
|---|
| Citation |  Feng, DM; DiPardo, RM; Wai, JM; Chang, RK; Di Marco, CN; Murphy, KL; Ransom, RW; Reiss, DR; Tang, C; Prueksaritanont, T; Pettibone, DJ; Bock, MG; Kuduk, SD A new class of bradykinin B1 receptor antagonists with high oral bioavailability and minimal PXR activity. Bioorg Med Chem Lett18:682-7 (2008) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| B1 bradykinin receptor |
|---|
| Name: | B1 bradykinin receptor |
|---|
| Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40508.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46663 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
|---|
| BDBM50371655 |
|---|
| n/a |
|---|
| Name | BDBM50371655 |
|---|
| Synonyms: | CHEMBL402630 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H21Cl2F3N4O4 |
|---|
| Mol. Mass. | 557.349 |
|---|
| SMILES | C[C@@H](NC(=O)C1(CC1)NC(=O)c1cc(C)on1)c1ncc(cc1F)-c1cc(Cl)cc(Cl)c1OCC(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
