Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEcto-5'-nucleotidase (e5'NT)
LigandBDBM50336767
Substrate/Competitorn/a
Meas. Tech.ChEMBL_463991
Ki>100000±n/a nM
Citation Weyler SBaqi YHillmann PKaulich MHunder AMMüller IAMüller CE Combinatorial synthesis of anilinoanthraquinone derivatives and evaluation as non-nucleotide-derived P2Y2 receptor antagonists. Bioorg Med Chem Lett 18:223-7 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ecto-5'-nucleotidase (e5'NT)
Name:Ecto-5'-nucleotidase (e5'NT)
Synonyms:5'-nucleotidase | Ecto-5-nucleotidase (e5'NT) | NT
Type:Enzyme
Mol. Mass.:63971.44
Organism:Rattus norvegicus (Rat)
Description:P21588
Residue:576
Sequence:
MRPAAATAPKWLLLALSALLPLWPTAKSWELTIMHTNDVHSRLEQTSDDSTKCLNASLCV
GGVARLFTKVQQIRKEEPNVLLLDAGDQYQGTIWFTVYKGLEVAHFMNLLGYDAMALGNH
EFDNGVEGLIDPLLRNVKFPILSANIKARGPLAPQISGLYLPYKVLSVGGEVVGIVGYTS
KETPFLSNPGTNLVFEDEVTALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDV
VVGGHTNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVEFDDKG
NVVTSYGNPILLNSTIREDAAIKADINQWRIKLDNYSTQELGRTIVYLNGSAQECRFREC
NMGNLICDAMINNNLRHPDEMFWNHVSMCIVNGGGIRSPIDERNNGTITWENLAAVLPFG
GTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDISRKPWDRVVQLKVLCTK
CRVPIYEPLEMDKVYKVVLPSYLVNGGDGFQMIKDELLKHDSGDQDISVVSEYISKMKVI
YPAVEGRIKFSAASHYQGSFPLIILSFWAVILVLYQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336767
n/a
NameBDBM50336767
Synonyms:CHEMBL257495 | PSB-716 | sodium 1-amino-4-(2-methoxyphenylamino)-9,10-dioxo-9,10-dihydroanthracene-2-sulfonate
TypeSmall organic molecule
Emp. Form.C21H15N2O6S
Mol. Mass.423.419
SMILESCOc1ccccc1Nc1cc(c(N)c2C(=O)c3ccccc3C(=O)c12)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: