| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Isoprenyl transferase |
|---|
| Ligand | BDBM50372770 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_465860 (CHEMBL951083) |
|---|
| IC50 | 1100±n/a nM |
|---|
| Citation |  Peukert, S; Sun, Y; Zhang, R; Hurley, B; Sabio, M; Shen, X; Gray, C; Dzink-Fox, J; Tao, J; Cebula, R; Wattanasin, S Design and structure-activity relationships of potent and selective inhibitors of undecaprenyl pyrophosphate synthase (UPPS): tetramic, tetronic acids and dihydropyridin-2-ones. Bioorg Med Chem Lett18:1840-4 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Isoprenyl transferase |
|---|
| Name: | Isoprenyl transferase |
|---|
| Synonyms: | Di-trans,poly-cis-decaprenylcistransferase | Ditrans,polycis-undecaprenyl-diphosphate synthase | ISPT_STRPN | UDS | UPP synthase | Undecaprenyl diphosphate synthase | Undecaprenyl pyrophosphate synthase | uppS |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28705.02 |
|---|
| Organism: | Streptococcus pneumoniae |
|---|
| Description: | ChEMBL_465860 |
|---|
| Residue: | 252 |
|---|
| Sequence: | MFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAAN
KLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDRLPK
QTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDVLDAKINPGDITEELIG
NYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAIL
AYNRRHRRFGGV
|
|
|
|---|
| BDBM50372770 |
|---|
| n/a |
|---|
| Name | BDBM50372770 |
|---|
| Synonyms: | CHEMBL256223 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H23N3O3 |
|---|
| Mol. Mass. | 413.4684 |
|---|
| SMILES | O=C(Nc1ccc(Nc2ccccc2)cc1)C1C(=O)CC(Cc2ccccc2)NC1=O |
|---|
| Structure | 
|
|---|
Search and Browse
