Reaction Details |
| Report a problem with these data |
Target | Isoprenyl transferase |
---|
Ligand | BDBM50372770 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_465860 (CHEMBL951083) |
---|
IC50 | 1100±n/a nM |
---|
Citation | Peukert, S; Sun, Y; Zhang, R; Hurley, B; Sabio, M; Shen, X; Gray, C; Dzink-Fox, J; Tao, J; Cebula, R; Wattanasin, S Design and structure-activity relationships of potent and selective inhibitors of undecaprenyl pyrophosphate synthase (UPPS): tetramic, tetronic acids and dihydropyridin-2-ones. Bioorg Med Chem Lett18:1840-4 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Isoprenyl transferase |
---|
Name: | Isoprenyl transferase |
Synonyms: | Di-trans,poly-cis-decaprenylcistransferase | Ditrans,polycis-undecaprenyl-diphosphate synthase | ISPT_STRPN | UDS | UPP synthase | Undecaprenyl diphosphate synthase | Undecaprenyl pyrophosphate synthase | uppS |
Type: | PROTEIN |
Mol. Mass.: | 28705.02 |
Organism: | Streptococcus pneumoniae |
Description: | ChEMBL_465860 |
Residue: | 252 |
Sequence: | MFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFGHKAGMEALQTVTKAAN
KLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPELHANNVKIQMIGETDRLPK
QTFEALTKAEELTKNNTGLILNFALNYGGRAEITQALKLISQDVLDAKINPGDITEELIG
NYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYSELYFTDTLWPDFDEAALQEAIL
AYNRRHRRFGGV
|
|
|
BDBM50372770 |
---|
n/a |
---|
Name | BDBM50372770 |
Synonyms: | CHEMBL256223 |
Type | Small organic molecule |
Emp. Form. | C25H23N3O3 |
Mol. Mass. | 413.4684 |
SMILES | O=C(Nc1ccc(Nc2ccccc2)cc1)C1C(=O)CC(Cc2ccccc2)NC1=O |
Structure |
|