Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcGMP-inhibited 3',5'-cyclic phosphodiesterase B
LigandBDBM14761
Substrate/Competitorn/a
Meas. Tech.ChEMBL_466944
Ki 56±n/a nM
Citation Kulkarni SSPatel MRTalele TT CoMFA and HQSAR studies on 6,7-dimethoxy-4-pyrrolidylquinazoline derivatives as phosphodiesterase10A inhibitors. Bioorg Med Chem 16:3675-86 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cGMP-inhibited 3',5'-cyclic phosphodiesterase B
Name:Phosphodiesterase 3 and 5 (PDE3 and PDE5)
Synonyms:CGI-PDE B | CGIP1 | CGIPDE1 | Cyclic GMP-inhibited phosphodiesterase B | Phosphodiesterase 3B | Phosphodiesterase 3B (PDE3B) | Phosphodiesterase Type 3 (PDE3B) | cGMP-inhibited 3,5-cyclic phosphodiesterase B
Type:Enzyme
Mol. Mass.:124318.95
Organism:Homo sapiens (Human)
Description:PDE3B was generated from the full-length recombinant human clone transfected into Sf9 cells.
Residue:1112
Sequence:
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELR
PPPASPQQPRRCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGD
AGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLLASFVWWVSFTSLGSL
PSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEAR
NMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGP
FNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDT
ADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSG
KSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLD
LILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQF
MNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRIN
HGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY
EQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDN
DTESGDDEDGEELDTEDEEMENNLNPKPPRRKSRRRIFCQLMHHLTENHKIWKEIVEEEE
KCKADGNKLQVENSSLPQADEIQVIEEADEEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14761
n/a
NameBDBM14761
Synonyms:(R)-6,7-Dimethoxy-4-[3-(naphthalen-1-yloxy)-pyrrolidin-1-yl]-quinazoline | 6,7-Dimethoxy-4-pyrrolidylquinazoline 22 | 6,7-dimethoxy-4-[(3R)-3-(naphthalen-1-yloxy)pyrrolidin-1-yl]quinazoline
TypeSmall organic molecule
Emp. Form.C24H23N3O3
Mol. Mass.401.4577
SMILESCOc1cc2ncnc(N3CC[C@H](C3)Oc3cccc4ccccc34)c2cc1OC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: