| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Lysophosphatidic acid receptor 2 |
|---|
| Ligand | BDBM50373814 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_468543 (CHEMBL930968) |
|---|
| IC50 | 1300±n/a nM |
|---|
| Citation |  Beck, HP; Kohn, T; Rubenstein, S; Hedberg, C; Schwandner, R; Hasslinger, K; Dai, K; Li, C; Liang, L; Wesche, H; Frank, B; An, S; Wickramasinghe, D; Jaen, J; Medina, J; Hungate, R; Shen, W Discovery of potent LPA2 (EDG4) antagonists as potential anticancer agents. Bioorg Med Chem Lett18:1037-41 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Lysophosphatidic acid receptor 2 |
|---|
| Name: | Lysophosphatidic acid receptor 2 |
|---|
| Synonyms: | EDG4 | LPA receptor 2 | LPA-2 | LPA2 | LPAR2 | LPAR2_HUMAN | Lysophosphatidic acid receptor 2 | Lysophosphatidic acid receptor Edg-4 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 39103.44 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1451385 |
|---|
| Residue: | 351 |
|---|
| Sequence: | MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
|
|
|
|---|
| BDBM50373814 |
|---|
| n/a |
|---|
| Name | BDBM50373814 |
|---|
| Synonyms: | CHEMBL270877 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H26F3N5O |
|---|
| Mol. Mass. | 445.4806 |
|---|
| SMILES | COc1ccccc1N1CCN(C[C@H](C)Nc2nc(nc3ccccc23)C(F)(F)F)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
