Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 1
LigandBDBM50373818
Substrate/Competitorn/a
Meas. Tech.ChEMBL_468544
IC50 50±n/a nM
Citation Beck HPKohn TRubenstein SHedberg CSchwandner RHasslinger KDai KLi CLiang LWesche HFrank BAn SWickramasinghe DJaen JMedina JHungate RShen W Discovery of potent LPA2 (EDG4) antagonists as potential anticancer agents. Bioorg Med Chem Lett 18:1037-41 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 1
Name:Lysophosphatidic acid receptor 1
Synonyms:LPA receptor 1 | LPA-1 | LPAR1 | Lysophosphatidic acid receptor 1 (LPA1) | Lysophosphatidic acid receptor Edg-2
Type:Enzyme
Mol. Mass.:41120.55
Organism:Homo sapiens (Human)
Description:Q92633
Residue:364
Sequence:
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50373818
n/a
NameBDBM50373818
Synonyms:CHEMBL404575
TypeSmall organic molecule
Emp. Form.C19H18N2O3
Mol. Mass.322.3578
SMILESCC(OC(=O)Nc1c(C)noc1-c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: