Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP2 subtype
LigandBDBM35847
Substrate/Competitorn/a
Meas. Tech.ChEMBL_468777
Ki 4.9±n/a nM
Citation Xiao YAraldi GLZhao ZReddy AKarra SBrugger NFischer DPalmer EBao BMcKenna SD Synthesis and evaluation of a gamma-lactam as a highly selective EP2 and EP4 receptor agonist. Bioorg Med Chem Lett 18:821-4 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP2 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostanoid EP2 Receptor
Type:Enzyme
Mol. Mass.:39775.71
Organism:Homo sapiens (Human)
Description:P43116
Residue:358
Sequence:
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35847
n/a
NameBDBM35847
Synonyms:(15S)-prostaglandin E2 | (5Z,11alpha,13E,15S)-11,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (5Z,13E,15S)-11alpha,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (E,Z)-(1R,2R,3R)-7-(3-Hydroxy-2-((3S)-(3-hydroxy-1-octenyl))-5-oxocyclopentyl)-5-heptenoic acid | CHEMBL548 | DINOPROSTONE | PGE2 | [3H]Dinoprostone | [3H]PGE2 | [3H]Prostaglandin E2 | prostaglandin E2
Typeradiolabeled ligand
Emp. Form.C20H32O5
Mol. Mass.352.4651
SMILESCCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: