Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP4 subtype
LigandBDBM50373942
Substrate/Competitorn/a
Meas. Tech.ChEMBL_468779
Ki 0.05±n/a nM
Citation Xiao YAraldi GLZhao ZReddy AKarra SBrugger NFischer DPalmer EBao BMcKenna SD Synthesis and evaluation of a gamma-lactam as a highly selective EP2 and EP4 receptor agonist. Bioorg Med Chem Lett 18:821-4 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP4 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP4 subtype | PGE2 receptor EP4 subtype | PTGER2 | PTGER4 | Prostanoid EP4 receptor
Type:Enzyme
Mol. Mass.:53134.53
Organism:Homo sapiens (Human)
Description:P35408
Residue:488
Sequence:
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50373942
n/a
NameBDBM50373942
Synonyms:CHEMBL272276
TypeSmall organic molecule
Emp. Form.C23H25NO4
Mol. Mass.379.4489
SMILESO[C@@H](Cc1ccccc1)\C=C\[C@H]1CCC(=O)N1CCc1ccc(cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: