Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50374597 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_469590 (CHEMBL934063) |
---|
Ki | 11.26±n/a nM |
---|
Citation | Mésangeau, C; Narayanan, S; Green, AM; Shaikh, J; Kaushal, N; Viard, E; Xu, YT; Fishback, JA; Poupaert, JH; Matsumoto, RR; McCurdy, CR Conversion of a highly selective sigma-1 receptor-ligand to sigma-2 receptor preferring ligands with anticocaine activity. J Med Chem51:1482-6 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50374597 |
---|
n/a |
---|
Name | BDBM50374597 |
Synonyms: | CHEMBL271772 | US9604926, Compound CM-121 | US9724435, Compound CM-121 |
Type | Small organic molecule |
Emp. Form. | C21H31N3O2 |
Mol. Mass. | 357.4897 |
SMILES | O=c1oc2ccccc2n1CCCCN1CCN(CC1)C1CCCCC1 |
Structure |
|