Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine receptor (H3)
LigandBDBM50060582
Substrate/Competitorn/a
Meas. Tech.ChEMBL_471591
IC50 820±n/a nM
Citation Bembenek SDKeith JMLetavic MAApodaca RBarbier AJDvorak LAluisio LMiller KLLovenberg TWCarruthers NI Lead identification of acetylcholinesterase inhibitors-histamine H3 receptor antagonists from molecular modeling. Bioorg Med Chem 16:2968-73 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine receptor (H3)
Name:Histamine receptor (H3 and H4)
Synonyms:G-protein coupled receptor 97 | HH3R | HISTAMINE H3 | HRH3 | Histamine H3 Receptor | Histamine H3 receptor (H3) | Histamine H3L | Histamine receptor (H3 and H4)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48691.47
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH3R receptors.
Residue:445
Sequence:
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060582
n/a
NameBDBM50060582
Synonyms:1,10-Bis(trimethyl ammonium)decane dibromide | 1,10-bis-(trimethyl ammonium) decane dibromide | CHEMBL1134 | DECAMETHONIUM | DECAMETHONIUM BROMIDE | Decamethonium Iodide | N,N,N'',N''-Tetramethyl-decane-1,10-diammonium; dibromide | N,N,N,N'',N'',N''-Hexamethyldecane-1,10-diammoniumdibromide | Syncurine | decane-1,10-bis(trimethylammonium bromide)
TypeSmall organic molecule
Emp. Form.C16H38N2
Mol. Mass.258.4852
SMILESC[N+](C)(C)CCCCCCCCCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: