Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRNAse A
LigandBDBM50375418
Substrate/Competitorn/a
Meas. Tech.ChEMBL_471807
Ki 13200±n/a nM
Citation Ghosh KSDebnath JDutta PSahoo BKDasgupta S Exploring the potential of 3'-O-carboxy esters of thymidine as inhibitors of ribonuclease A and angiogenin. Bioorg Med Chem 16:2819-28 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
RNAse A
Name:RNAse A
Synonyms:Ribonuclease A | Ribonuclease pancreatic
Type:Protein
Mol. Mass.:17653.66
Organism:Homo sapiens (Human)
Description:n/a
Residue:156
Sequence:
MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50375418
n/a
NameBDBM50375418
Synonyms:CHEMBL408119
TypeSmall organic molecule
Emp. Form.C10H15N2O8P
Mol. Mass.322.2085
SMILESCc1cn([C@H]2C[C@H](OP(O)(O)=O)[C@@H](CO)O2)c(=O)[nH]c1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: