Reaction Details |
| Report a problem with these data |
Target | Ribonuclease pancreatic |
---|
Ligand | BDBM50375420 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_471807 (CHEMBL940091) |
---|
Ki | 42000±n/a nM |
---|
Citation | Ghosh, KS; Debnath, J; Dutta, P; Sahoo, BK; Dasgupta, S Exploring the potential of 3'-O-carboxy esters of thymidine as inhibitors of ribonuclease A and angiogenin. Bioorg Med Chem16:2819-28 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ribonuclease pancreatic |
---|
Name: | Ribonuclease pancreatic |
Synonyms: | RIB1 | RNAS1_HUMAN | RNASE1 | RNAse A | RNS1 | Ribonuclease A | Ribonuclease pancreatic |
Type: | Protein |
Mol. Mass.: | 17653.66 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 156 |
Sequence: | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
|
|
|
BDBM50375420 |
---|
n/a |
---|
Name | BDBM50375420 |
Synonyms: | CHEMBL266234 |
Type | Small organic molecule |
Emp. Form. | C12H16N2O6 |
Mol. Mass. | 284.2652 |
SMILES | CC(=O)O[C@H]1C[C@@H](O[C@@H]1CO)n1cc(C)c(=O)[nH]c1=O |
Structure |
|