| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribonuclease pancreatic |
|---|
| Ligand | BDBM50375420 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_471807 (CHEMBL940091) |
|---|
| Ki | 42000±n/a nM |
|---|
| Citation |  Ghosh, KS; Debnath, J; Dutta, P; Sahoo, BK; Dasgupta, S Exploring the potential of 3'-O-carboxy esters of thymidine as inhibitors of ribonuclease A and angiogenin. Bioorg Med Chem16:2819-28 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ribonuclease pancreatic |
|---|
| Name: | Ribonuclease pancreatic |
|---|
| Synonyms: | RIB1 | RNAS1_HUMAN | RNASE1 | RNAse A | RNS1 | Ribonuclease A | Ribonuclease pancreatic |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17653.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 156 |
|---|
| Sequence: | MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
|
|
|
|---|
| BDBM50375420 |
|---|
| n/a |
|---|
| Name | BDBM50375420 |
|---|
| Synonyms: | CHEMBL266234 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H16N2O6 |
|---|
| Mol. Mass. | 284.2652 |
|---|
| SMILES | CC(=O)O[C@H]1C[C@@H](O[C@@H]1CO)n1cc(C)c(=O)[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
