Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM-kinase kinase beta
LigandBDBM50216680
Substrate/Competitorn/a
Meas. Tech.ChEMBL_473615
Ki 13000±n/a nM
Citation Fedorov OMarsden BPogacic VRellos PMüller SBullock ANSchwaller JSundström MKnapp S A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. Proc Natl Acad Sci USA 104:20523-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM-kinase kinase beta
Name:CaM-kinase kinase beta
Synonyms:Calcium/calmodulin-dependent protein kinase kinase 2 (CaMKKB) | Calcium/calmodulin-dependent protein kinase kinase beta
Type:Enzyme Catalytic Domain
Mol. Mass.:64746.61
Organism:Homo sapiens (Human)
Description:gi_27437015
Residue:588
Sequence:
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50216680
n/a
NameBDBM50216680
Synonyms:1-(2-(isoquinoline-5-sulfonamido)ethyl)guanidine | CHEMBL143054 | H-1004 | N-(2-Guanidinoethyl)-5-isoquinolinesulfonamide | N-(2-guanidinoethyl)isoquinoline-5-sulfonamide
TypeSmall organic molecule
Emp. Form.C12H15N5O2S
Mol. Mass.293.345
SMILES[#7]\[#6](-[#7])=[#7]\[#6]-[#6]-[#7]S(=O)(=O)c1cccc2cnccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: