Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50375695 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_473939 (CHEMBL950319) |
---|
Ki | 2.75±n/a nM |
---|
Citation | Ryu, EK; Wu, Z; Chen, K; Lazarus, LH; Marczak, ED; Sasaki, Y; Ambo, A; Salvadori, S; Ren, C; Zhao, H; Balboni, G; Chen, X Synthesis of a potent and selective (18)F-labeled delta-opioid receptor antagonist derived from the Dmt-Tic pharmacophore for positron emission tomography imaging. J Med Chem51:1817-23 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44503.11 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
Residue: | 398 |
Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
BDBM50375695 |
---|
n/a |
---|
Name | BDBM50375695 |
Synonyms: | CHEMBL270984 |
Type | Small organic molecule |
Emp. Form. | C43H49N5O9 |
Mol. Mass. | 779.8773 |
SMILES | Cc1cc(O)cc(O)c1C[C@H](N)C(=O)N1Cc2ccccc2C[C@@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCNC(=O)OCc1ccccc1)C(O)=O |
Structure |
|