Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIII
LigandBDBM10881
Substrate/Competitorn/a
Meas. Tech.ChEMBL_475794
Ki 19±n/a nM
Citation Di Fiore APedone CAntel JWaldeck HWitte AWurl MScozzafava ASupuran CTDe Simone G Carbonic anhydrase inhibitors: the X-ray crystal structure of ethoxzolamide complexed to human isoform II reveals the importance of thr200 and gln92 for obtaining tight-binding inhibitors. Bioorg Med Chem Lett 18:2669-74 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIII
Name:Carbonic anhydrase XIII
Synonyms:CA-XIII | Carbonate dehydratase XIII | Carbonic anhydrase 13
Type:Enzyme
Mol. Mass.:29522.80
Organism:Mus musculus (mouse)
Description:Murine cloned isozyme
Residue:262
Sequence:
MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10881
n/a
NameBDBM10881
Synonyms:CHEMBL288100 | METHAZOLAMIDE | MZA3 | Methazolamide | Methazolamide (MZA) | Methazolamide, MZA | N-[(2Z)-3-methyl-5-sulfamoyl-2,3-dihydro-1,3,4-thiadiazol-2-ylidene]acetamide | Sulfonamide, 2 | cid_4100 | sulfonamide 2
TypeSmall organic molecule
Emp. Form.C5H8N4O3S2
Mol. Mass.236.272
SMILESCC(=O)N=c1sc(nn1C)S(N)(=O)=O |w:3.2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: