| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50238620 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_477926 (CHEMBL923551) |
|---|
| Ki | 1410±n/a nM |
|---|
| Citation |  Tidgewell, K; Groer, CE; Harding, WW; Lozama, A; Schmidt, M; Marquam, A; Hiemstra, J; Partilla, JS; Dersch, CM; Rothman, RB; Bohn, LM; Prisinzano, TE Herkinorin analogues with differential beta-arrestin-2 interactions. J Med Chem51:2421-31 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50238620 |
|---|
| n/a |
|---|
| Name | BDBM50238620 |
|---|
| Synonyms: | (2S,4aR,6aR,7R,9S,10aS,10bR)-9-(4-Bromobenzoyloxy)-2-(3-furanyl)-dodecahydro-6a,10b-dimethyl-4,10-dioxo-2H-naphtho-[2,1-c]pyran-7-carboxylic Acid Methyl Ester | (2S,4aS,6aR,7R,9S,10aS,10bR)-9-(4-Bromobenzoyloxy)-2-(3-furanyl)dodecahydro-6a,10b-dimethyl-4,-10-dioxo-2H-naphtho[2,1-c]pyran-7-carboxylic Acid Methyl Ester | CHEMBL259299 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H29BrO8 |
|---|
| Mol. Mass. | 573.429 |
|---|
| SMILES | COC(=O)[C@@H]1C[C@H](OC(=O)c2ccc(Br)cc2)C(=O)[C@H]2[C@@]1(C)CC[C@H]1C(=O)O[C@@H](C[C@]21C)c1ccoc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
