Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase II alpha
LigandBDBM31093
Substrate/Competitorn/a
Meas. Tech.ChEMBL_477965
IC50 20500±n/a nM
Citation Manfredi MGEcsedy JAMeetze KABalani SKBurenkova OChen WGalvin KMHoar KMHuck JJLeRoy PJRay ETSells TBStringer BStroud SGVos TJWeatherhead GSWysong DRZhang MBolen JBClaiborne CF Antitumor activity of MLN8054, an orally active small-molecule inhibitor of Aurora A kinase. Proc Natl Acad Sci USA 104:4106-11 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase II alpha
Name:Casein kinase II alpha
Synonyms:CK II | CK2 | CK2- alpha | CK2A1 | CSNK2A1 | Casein kinase II (CK2) | Casein kinase II alpha/beta | Casein kinase II subunit alpha | Casein kinase II subunit alpha (CK2 alpha) | Casein kinase II subunit alpha (CK2A1) | Casein kinase II subunit alpha (CK2a I174A) | Casein kinase II subunit alpha (CK2a V66A) | Casein kinase II subunit alpha (CK2a dm V66I174AA) | Casein kinase II subunit alpha (CK2a) | Casein kinase II subunit alpha (CK2α)
Type:Enzyme
Mol. Mass.:45151.12
Organism:Homo sapiens (Human)
Description:P68400
Residue:391
Sequence:
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31093
n/a
NameBDBM31093
Synonyms:4-[[7-[2,6-bis(fluoranyl)phenyl]-9-chloranyl-5H-pyrimido[5,4-d][2]benzazepin-2-yl]amino]benzoic acid | 4-[[9-chloro-7-(2,6-difluorophenyl)-5H-pyrimido[5,4-d][2]benzazepin-2-yl]amino]benzoic acid | CHEMBL259084 | MLN-8054 | cid_11712649
TypeSmall organic molecule
Emp. Form.C25H15ClF2N4O2
Mol. Mass.476.862
SMILESOC(=O)c1ccc(Nc2ncc3CN=C(c4cc(Cl)ccc4-c3n2)c2c(F)cccc2F)cc1 |c:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: