Reaction Details |
| Report a problem with these data |
Target | Bcl2-associated agonist of cell death |
---|
Ligand | BDBM50376902 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_478760 (CHEMBL936491) |
---|
Ki | 1000±n/a nM |
---|
Citation | Nguyen, M; Marcellus, RC; Roulston, A; Watson, M; Serfass, L; Murthy Madiraju, SR; Goulet, D; Viallet, J; Bélec, L; Billot, X; Acoca, S; Purisima, E; Wiegmans, A; Cluse, L; Johnstone, RW; Beauparlant, P; Shore, GC Small molecule obatoclax (GX15-070) antagonizes MCL-1 and overcomes MCL-1-mediated resistance to apoptosis. Proc Natl Acad Sci U S A104:19512-7 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl2-associated agonist of cell death |
---|
Name: | Bcl2-associated agonist of cell death |
Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | Bcl-2-binding component 6 | Bcl-2-like protein 8 | Bcl-XL/Bcl-2-associated death promoter | Bcl2 antagonist of cell death | Bcl2-L-8 | Bcl2-antagonist of cell death (BAD) |
Type: | PROTEIN |
Mol. Mass.: | 18393.69 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_478760 |
Residue: | 168 |
Sequence: | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
|
|
|
BDBM50376902 |
---|
n/a |
---|
Name | BDBM50376902 |
Synonyms: | CHEMBL408194 |
Type | Small organic molecule |
Emp. Form. | C20H19N3O |
Mol. Mass. | 317.3844 |
SMILES | COC1=CC(=N\C1=C/c1[nH]c(C)cc1C)c1cc2ccccc2[nH]1 |c:4,t:2| |
Structure |
|