| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-related protein A1 |
|---|
| Ligand | BDBM50376902 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_478763 (CHEMBL936499) |
|---|
| Ki | 1000±n/a nM |
|---|
| Citation |  Nguyen, M; Marcellus, RC; Roulston, A; Watson, M; Serfass, L; Murthy Madiraju, SR; Goulet, D; Viallet, J; Bélec, L; Billot, X; Acoca, S; Purisima, E; Wiegmans, A; Cluse, L; Johnstone, RW; Beauparlant, P; Shore, GC Small molecule obatoclax (GX15-070) antagonizes MCL-1 and overcomes MCL-1-mediated resistance to apoptosis. Proc Natl Acad Sci U S A104:19512-7 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-related protein A1 |
|---|
| Name: | Bcl-2-related protein A1 |
|---|
| Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
|---|
| Type: | Apoptosis regulator protein |
|---|
| Mol. Mass.: | 20130.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 175 |
|---|
| Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
|---|
| BDBM50376902 |
|---|
| n/a |
|---|
| Name | BDBM50376902 |
|---|
| Synonyms: | CHEMBL408194 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19N3O |
|---|
| Mol. Mass. | 317.3844 |
|---|
| SMILES | COC1=CC(=N\C1=C/c1[nH]c(C)cc1C)c1cc2ccccc2[nH]1 |c:4,t:2| |
|---|
| Structure | 
|
|---|
Search and Browse
