Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 15
LigandBDBM26193
Substrate/Competitorn/a
Meas. Tech.ChEMBL_479319
Ki 7200±n/a nM
Citation Innocenti AHilvo MScozzafava AParkkila SSupuran CT Carbonic anhydrase inhibitors: Inhibition of the new membrane-associated isoform XV with phenols. Bioorg Med Chem Lett 18:3593-6 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 15
Name:Carbonic anhydrase 15
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35484.02
Organism:Mus musculus
Description:ChEMBL_651955
Residue:324
Sequence:
MWALDFLLSFLLIQLAAQVDSSGTWCYDSQDPKCGPAHWKELAPACGGPTQSPINIDLRL
VQRDYTLKPFIFQGYDSAPQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEYRLLQ
LHFHWGSPGHQGSEHSLDEKHGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLVEEDR
DNTNFSAIVSGLKNLSSPGVAVNLTSTFALASLLPSALRLLRYYRYSGSLTTPGCEPAVL
WTVFENTVPIGHAQVVQFQAVLQTGPPGLHPRPLTSNFRPQQPLGGRRISASPEASVRSS
VSTLPCLHLALVGLGVGLRLWQGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26193
n/a
NameBDBM26193
Synonyms:2-Hydroxybenzoate, I | 2-hydroxybenzoic acid | CHEMBL424 | phenol derivative, 7 | salicylic acid
TypeSmall organic molecule
Emp. Form.C7H6O3
Mol. Mass.138.1207
SMILESOC(=O)c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: