Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50240153
Substrate/Competitorn/a
Meas. Tech.ChEMBL_479369
EC50 3200±n/a nM
Citation McAtee JJDodson JWDowdell SEGirard GRGoodman KBHilfiker MASehon CASha DWang GZWang NViet AQZhang DAiyar NVBehm DJCarballo LHEvans CAFries HENagilla RRoethke TJXu XYuan CCDouglas SANeeb MJ Development of potent and selective small-molecule human Urotensin-II antagonists. Bioorg Med Chem Lett 18:3500-3 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:K-OR-1 | KOR-1 | Kappa-opioid receptor (KOR) | Kappa-type opioid receptor (KOPR) | Kappa-type opioid receptor (KOR) | Kappa-type opioid receptor (Kappa) | OPIATE Kappa | OPRK | OPRK1 | kappa opioid receptor (KOR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42648.76
Organism:Homo sapiens (Human)
Description:P41145
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240153
n/a
NameBDBM50240153
Synonyms:(+/-)-2-((3,4-dichlorophenyl)(methyl)amino)-1-(3-phenyl-2-(pyrrolidin-1-ylmethyl)piperidin-1-yl)ethanone | CHEMBL254356 | rac-2-((3,4-dichlorophenyl)(methyl)amino)-1-(3-phenyl-2-(pyrrolidin-1-ylmethyl)piperidin-1-yl)ethanone
TypeSmall organic molecule
Emp. Form.C25H31Cl2N3O
Mol. Mass.460.439
SMILESCN(CC(=O)N1CCCC(C1CN1CCCC1)c1ccccc1)c1ccc(Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: