Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM50165069 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_479714 (CHEMBL921474) |
---|
Ki | 612±n/a nM |
---|
Citation | Gillespie, RJ; Cliffe, IA; Dawson, CE; Dourish, CT; Gaur, S; Jordan, AM; Knight, AR; Lerpiniere, J; Misra, A; Pratt, RM; Roffey, J; Stratton, GC; Upton, R; Weiss, SM; Williamson, DS Antagonists of the human adenosine A2A receptor. Part 3: Design and synthesis of pyrazolo[3,4-d]pyrimidines, pyrrolo[2,3-d]pyrimidines and 6-arylpurines. Bioorg Med Chem Lett18:2924-9 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36520.92 |
Organism: | Homo sapiens (Human) |
Description: | P30542 |
Residue: | 326 |
Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
BDBM50165069 |
---|
n/a |
---|
Name | BDBM50165069 |
Synonyms: | 9-(2,6-Difluoro-benzyl)-6-furan-2-yl-9H-purin-2-ylamine | 9-(2,6-difluorobenzyl)-6-(furan-2-yl)-9H-purin-2-amine | CHEMBL371615 |
Type | Small organic molecule |
Emp. Form. | C16H11F2N5O |
Mol. Mass. | 327.2882 |
SMILES | Nc1nc(-c2ccco2)c2ncn(Cc3c(F)cccc3F)c2n1 |
Structure |
|