Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSn1-specific diacylglycerol lipase alpha
LigandBDBM50377666
Substrate/Competitorn/a
Meas. Tech.ChEMBL_479895
IC50>10000±n/a nM
Citation Ortar GSchiano Moriello ACascio MGDe Petrocellis LLigresti AMorera ENalli MDi Marzo V New tetrazole-based selective anandamide uptake inhibitors. Bioorg Med Chem Lett 18:2820-4 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sn1-specific diacylglycerol lipase alpha
Name:Sn1-specific diacylglycerol lipase alpha
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:114947.74
Organism:Homo sapiens (Human)
Description:ChEMBL_1449471
Residue:1042
Sequence:
MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNLVDHGR
GYLGILLSCMIAEMAIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLT
QYYTSCNDLTAKNVTLGMVVCNWVVILSVCITVLCVFDPTGRTFVKLRATKRRQRNLRTY
NLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGL
VLLRQRQRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSQEMLRYKEVCYYMLFAL
AAYGWPMYLMRKPACGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAIRRHFLD
ENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVE
GHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAI
LSFLLRPQYPTLKCFAYSPPGGLLSEDAMEYSKEFVTAVVLGKDLVPRIGLSQLEGFRRQ
LLDVLQRSTKPKWRIIVGATKCIPKSELPEEVEVTTLASTRLWTHPSDLTIALSASTPLY
PPGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLN
KVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPLPTGPPMPTGLALELPTADHRN
SSVRSKSQSEMSLEGFSEGRLLSPVVAAAARQDPVELLLLSTQERLAAELQARRAPLATM
ESLSDTESLYSFDSRRSSGFRSIRGSPSLHAVLERDEGHLFYIDPAIPEENPSLSSRTEL
LAADSLSKHSQDTQPLEAALGSGGVTPERPPSAAANDEEEEVGGGGGGPASRGELALHNG
RLGDSPSPQVLEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILL
RAQFEPNLVPKPPRLFAGSADPSSGISLSPSFPLSSSGELMDLTPTGLSSQECLAADKIR
TSTPTGHGASPAKQDELVISAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50377666
n/a
NameBDBM50377666
Synonyms:CHEMBL257570
TypeSmall organic molecule
Emp. Form.C19H21N5O
Mol. Mass.335.4029
SMILESCC(C)Cn1nnnc1CNC(=O)c1ccc(cc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: