| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase 17B |
|---|
| Ligand | BDBM4814 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_531356 (CHEMBL990545) |
|---|
| Kd | 220±n/a nM |
|---|
| Citation |  McDermott, U; Sharma, SV; Dowell, L; Greninger, P; Montagut, C; Lamb, J; Archibald, H; Raudales, R; Tam, A; Lee, D; Rothenberg, SM; Supko, JG; Sordella, R; Ulkus, LE; Iafrate, AJ; Maheswaran, S; Njauw, CN; Tsao, H; Drew, L; Hanke, JH; Ma, XJ; Erlander, MG; Gray, NS; Haber, DA; Settleman, J Identification of genotype-correlated sensitivity to selective kinase inhibitors by using high-throughput tumor cell line profiling. Proc Natl Acad Sci U S A104:19936-41 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase 17B |
|---|
| Name: | Serine/threonine-protein kinase 17B |
|---|
| Synonyms: | DRAK2 | ST17B_HUMAN | STK17B | Serine/threonine-protein kinase 17B | Serine/threonine-protein kinase 17B (STK17B) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42332.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O94768 |
|---|
| Residue: | 372 |
|---|
| Sequence: | MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYA
AKFLKKRRRGQDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFS
LCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDF
GMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDN
QETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFEN
LFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSL
PNPHELVSDLLC
|
|
|
|---|
| BDBM4814 |
|---|
| n/a |
|---|
| Name | BDBM4814 |
|---|
| Synonyms: | CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fluoro-2-oxo-1,2-dihydro-3H-indol-3-ylidene)methyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide | N-[2-(diethylamino)ethyl]-5-{[(3Z)-5-fluoro-2-oxo-2,3-dihydro-1H-indol-3-ylidene]methyl}-2,4-dimethyl-1H-pyrrole-3-carboxamide | SU11248 | SUNITINIB | SUNITINIB MALATE | US10464902, Sunitinib | US9163010, Sunitinib | US9914707, SU11248 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H27FN4O2 |
|---|
| Mol. Mass. | 398.4738 |
|---|
| SMILES | CCN(CC)CCNC(=O)c1c(C)[nH]c(\C=C2/C(=O)Nc3ccc(F)cc23)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
