Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50260710
Substrate/Competitorn/a
Meas. Tech.ChEMBL_552264
Ki 242±n/a nM
Citation Omura HKawai MShima AIwata YIto FMasuda TOhta AMakita NOmoto KSugimoto HKikuchi AIwata HAndo K The SAR studies of novel CB2 selective agonists, benzimidazolone derivatives. Bioorg Med Chem Lett 18:3310-4 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50260710
n/a
NameBDBM50260710
Synonyms:(S)-N-(1-amino-3,3-dimethyl-1-oxobutan-2-yl)-2-oxo-3-(2-(pyrrolidin-1-yl)ethyl)-2,3-dihydrobenzo[d]imidazole-1-carboxamide | CHEMBL524818
TypeSmall organic molecule
Emp. Form.C20H29N5O3
Mol. Mass.387.476
SMILESCC(C)(C)[C@H](NC(=O)n1c2ccccc2n(CCN2CCCC2)c1=O)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: