Reaction Details |
| Report a problem with these data |
Target | Myeloblastin |
---|
Ligand | BDBM50052693 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_508159 (CHEMBL1008217) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Méthot, N; Rubin, J; Guay, D; Beaulieu, C; Ethier, D; Reddy, TJ; Riendeau, D; Percival, MD Inhibition of the activation of multiple serine proteases with a cathepsin C inhibitor requires sustained exposure to prevent pro-enzyme processing. J Biol Chem282:20836-46 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Myeloblastin |
---|
Name: | Myeloblastin |
Synonyms: | PRTN3_MOUSE | Prtn3 |
Type: | PROTEIN |
Mol. Mass.: | 27628.93 |
Organism: | Mus musculus |
Description: | ChEMBL_508159 |
Residue: | 254 |
Sequence: | MSGSYPSPKGIHPFLLLALVVGGAVQASKIVGGHEARPHSRPYVASLQLSRFPGSHFCGG
TLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLND
VLLLQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVV
TFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSM
YVDWIQNVLRGAEP
|
|
|
BDBM50052693 |
---|
n/a |
---|
Name | BDBM50052693 |
Synonyms: | (2S,3S)-3-[(S)-3-Methyl-1-(3-methyl-butylcarbamoyl)-butylcarbamoyl]-oxirane-2-carboxylic acid ethyl ester | (2S,3S)-ethyl 3-(((S)-1-(isopentylamino)-4-methyl-1-oxopentan-2-yl)carbamoyl)oxirane-2-carboxylate | (2S,3S)-trans-epoxysuccinyl-L-leucylamido-3-methylbutane ethyl ester | 3-[3-Methyl-1-(3-methyl-butylcarbamoyl)-butylcarbamoyl]-oxirane-2-carboxylic acid ethyl ester | Aloxistatin | CHEMBL63440 |
Type | Small organic molecule |
Emp. Form. | C17H30N2O5 |
Mol. Mass. | 342.4305 |
SMILES | CCOC(=O)[C@H]1O[C@@H]1C(=O)N[C@@H](CC(C)C)C(=O)NCCC(C)C |r| |
Structure |
|