Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM21864 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_513621 (CHEMBL970712) |
---|
Ki | 12.7±n/a nM |
---|
Citation | Sakami, S; Maeda, M; Kawai, K; Aoki, T; Kawamura, K; Fujii, H; Hasebe, K; Nakajima, M; Endo, T; Ueno, S; Ito, T; Kamei, J; Nagase, H Structure-antitussive activity relationships of naltrindole derivatives. Identification of novel and potent antitussive agents. J Med Chem51:4404-11 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM21864 |
---|
n/a |
---|
Name | BDBM21864 |
Synonyms: | (21R)-22-(cyclopropylmethyl)-14-oxa-11,22-diazaheptacyclo[13.9.1.0^{1,13}.0^{2,21}.0^{4,12}.0^{5,10}.0^{19,25}]pentacosa-4(12),5,7,9,15,17,19(25)-heptaene-2,16-diol | (8R)-7-(cyclopropylmethyl)-5,6,7,8,14,14b-hexahydro-4,8-methano[1]benzofuro[2,3-a]pyrido[4,3-b]carbazole-1,8a(9H)-diol | NALTRINDOLE | [3H]-naltrindole |
Type | radiolabeled ligand |
Emp. Form. | C26H26N2O3 |
Mol. Mass. | 414.4962 |
SMILES | [H][C@@]12Cc3ccc(O)c4OC5c6[nH]c7ccccc7c6CC1(O)C5(CCN2CC1CC1)c34 |THB:27:26:21:31.2.3| |
Structure |
|