| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50245093 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_513621 (CHEMBL970712) |
|---|
| Ki | >3670±n/a nM |
|---|
| Citation |  Sakami, S; Maeda, M; Kawai, K; Aoki, T; Kawamura, K; Fujii, H; Hasebe, K; Nakajima, M; Endo, T; Ueno, S; Ito, T; Kamei, J; Nagase, H Structure-antitussive activity relationships of naltrindole derivatives. Identification of novel and potent antitussive agents. J Med Chem51:4404-11 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50245093 |
|---|
| n/a |
|---|
| Name | BDBM50245093 |
|---|
| Synonyms: | (5R,9R,13S,14S)-17-cyclopropylmethyl-6,7-didehydro-4,5-epoxy-5',6'-dihydro-3-methoxy-4'H-pyrrolo[3,2,1-ij]quinolino[2',1':6,7]morphinan-14-ol methanesulfonate | CHEMBL504916 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H32N2O3 |
|---|
| Mol. Mass. | 468.5867 |
|---|
| SMILES | COc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)c1c(C[C@@]35O)c2cccc3CCCn1c23 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
