Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCorticotropin releasing factor receptor 1
LigandBDBM50272638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_510097
Ki 2±n/a nM
Citation Yoon TDe Lombaert SBrodbeck RGulianello MKrause JEHutchison AHorvath RFGe PKehne JHoffman DChandrasekhar JDoller DHodgetts KJ 2-Arylpyrimidines: novel CRF-1 receptor antagonists. Bioorg Med Chem Lett 18:4486-90 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Corticotropin releasing factor receptor 1
Name:Corticotropin releasing factor receptor 1
Synonyms:CRF-R | CRF-R2 Alpha | CRF1 | CRH-R 1 | CRHR1 | Corticotropin-releasing factor receptor 1 (CRF-1) | Corticotropin-releasing factor receptor 1 (CRF1) | Corticotropin-releasing hormone receptor 1
Type:Enzyme
Mol. Mass.:50744.31
Organism:Homo sapiens (Human)
Description:P34998
Residue:444
Sequence:
MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50272638
n/a
NameBDBM50272638
Synonyms:2-(4-chloro-2,6-dimethoxyphenyl)-4-methoxy-6-methyl-N,N-dipropylpyrimidin-5-amine | CHEMBL525716
TypeSmall organic molecule
Emp. Form.C20H28ClN3O3
Mol. Mass.393.908
SMILESCCCN(CCC)c1c(C)nc(nc1OC)-c1c(OC)cc(Cl)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: