Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50272346
Substrate/Competitorn/a
Meas. Tech.ChEMBL_510483
EC50 170±n/a nM
Citation Cheng YAlbrecht BKBrown JBuchanan JLBuckner WHDiMauro EFEmkey RFremeau RTHarmange JCHoffman BJHuang LHuang MLee JHLin FFMartin MWNguyen HQPatel VFTomlinson SAWhite RDXia XHitchcock SA Discovery and optimization of a novel series of N-arylamide oxadiazoles as potent, highly selective and orally bioavailable cannabinoid receptor 2 (CB2) agonists. J Med Chem 51:5019-34 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:Brain-type cannabinoid receptor | CANNABINOID CB1 | CB-R | CB1 | Cannabinoid CB1 receptor | Cannabinoid receptor 1 (CB1)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52856.55
Organism:Rattus norvegicus (rat)
Description:P20272
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50272346
n/a
NameBDBM50272346
Synonyms:CHEMBL499060 | N-(5-tert-Butylisoxazol-3-yl)-3-(3-(2-chloro-4-fluorophenyl)-1,2,4-oxadiazol-5-yl)propanamide
TypeSmall organic molecule
Emp. Form.C18H18ClFN4O3
Mol. Mass.392.812
SMILESCC(C)(C)c1cc(NC(=O)CCc2nc(no2)-c2ccc(F)cc2Cl)no1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: