Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50272313
Substrate/Competitorn/a
Meas. Tech.ChEMBL_510476
EC50 75±n/a nM
Citation Cheng YAlbrecht BKBrown JBuchanan JLBuckner WHDiMauro EFEmkey RFremeau RTHarmange JCHoffman BJHuang LHuang MLee JHLin FFMartin MWNguyen HQPatel VFTomlinson SAWhite RDXia XHitchcock SA Discovery and optimization of a novel series of N-arylamide oxadiazoles as potent, highly selective and orally bioavailable cannabinoid receptor 2 (CB2) agonists. J Med Chem 51:5019-34 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50272313
n/a
NameBDBM50272313
Synonyms:3-(3-(2-Chloro-4-fluorophenyl)-1,2,4-oxadiazol-5-yl)-N-(4-(trifluoromethyl)phenyl)propanamide | CHEMBL500133
TypeSmall organic molecule
Emp. Form.C18H12ClF4N3O2
Mol. Mass.413.753
SMILESFc1ccc(-c2noc(CCC(=O)Nc3ccc(cc3)C(F)(F)F)n2)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: