Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4D
LigandBDBM50085135
Substrate/Competitorn/a
Meas. Tech.ChEMBL_511180
IC50 1±n/a nM
Citation Kodimuthali AJabaris SSPal M Recent advances on phosphodiesterase 4 inhibitors for the treatment of asthma and chronic obstructive pulmonary disease. J Med Chem 51:5471-89 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Synonyms:DPDE3 | PDE43 | PDE4D | Phosphodiesterase 4D
Type:Protein
Mol. Mass.:91092.69
Organism:Homo sapiens (Human)
Description:Q08499
Residue:809
Sequence:
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085135
n/a
NameBDBM50085135
Synonyms:4-(8-(3-nitrophenyl)-1,7-naphthyridin-6-yl)benzoic acid | 4-[8-(3-Nitro-phenyl)-[1,7]naphthyridin-6-yl]-benzoic acid | 4-[8-(3-nitrophenyl)-1,7-naphthyridin-6-yl]benzoic acid | CHEMBL74078
TypeSmall organic molecule
Emp. Form.C21H13N3O4
Mol. Mass.371.3456
SMILESOC(=O)c1ccc(cc1)-c1cc2cccnc2c(n1)-c1cccc(c1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: