Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAntrax lethal toxin
LigandBDBM78577
Substrate/Competitorn/a
Meas. Tech.ChEMBL_554441
IC50 4800±n/a nM
Citation Sanchez AMThomas DGillespie EJDamoiseaux RRogers JSaxe JPHuang JManchester MBradley KA Amiodarone and bepridil inhibit anthrax toxin entry into host cells. Antimicrob Agents Chemother 51:2403-11 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Antrax lethal toxin
Name:Antrax lethal toxin
Synonyms:Anthrax lethal factor | lethal factor
Type:PROTEIN
Mol. Mass.:93758.56
Organism:Bacillus anthracis
Description:ChEMBL_1460338
Residue:809
Sequence:
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE
RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD
ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV
YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE
QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR
YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS
DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT
ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP
DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN
QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG
RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE
FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST
DHAERLKVQKNAPKTFQFINDQIKFIINS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM78577
n/a
NameBDBM78577
Synonyms:BEPRIDIL | BEPRIDIL HYDROCHLORIDE | Bepridil | MLS000028456 | N-[3-(2-methylpropoxy)-2-(1-pyrrolidinyl)propyl]-N-(phenylmethyl)aniline;hydrochloride | N-[3-(2-methylpropoxy)-2-pyrrolidin-1-yl-propyl]-N-(phenylmethyl)aniline;hydrochloride | N-benzyl-N-[3-(2-methylpropoxy)-2-pyrrolidin-1-ylpropyl]aniline;hydrochloride | SMR000058419 | benzyl-(3-isobutoxy-2-pyrrolidino-propyl)-phenyl-amine;hydrochloride | cid_50088
TypeSmall organic molecule
Emp. Form.C24H34N2O
Mol. Mass.366.5396
SMILESCC(C)COCC(CN(Cc1ccccc1)c1ccccc1)N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: