Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, liver |
---|
Ligand | BDBM50292627 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_555395 (CHEMBL964792) |
---|
Ki | 12900±n/a nM |
---|
Citation | Chuang, S; Velkov, T; Horne, J; Porter, CJ; Scanlon, MJ Characterization of the drug binding specificity of rat liver fatty acid binding protein. J Med Chem51:3755-64 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, liver |
---|
Name: | Fatty acid-binding protein, liver |
Synonyms: | FABPL_RAT | Fabp1 | Fatty acid-binding protein, liver | Liver fatty acid binding protein (rat L-FABP) |
Type: | Protein |
Mol. Mass.: | 14274.39 |
Organism: | Rattus norvegicus (Rat) |
Description: | rat L-FABP |
Residue: | 127 |
Sequence: | MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIH
NEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVY
KRVSKRI
|
|
|
BDBM50292627 |
---|
n/a |
---|
Name | BDBM50292627 |
Synonyms: | (RS)-9-chloro-6-(2-chlorophenyl)-4-hydroxy-2,5-diazabicyclo[5.4.0]undeca-5,8,10,12-tetraen-3-one | 7-Chloro-5-(2-chloro-phenyl)-3-hydroxy-1,3-dihydro-benzo[e][1,4]diazepin-2-one | 7-Chloro-5-(2-chloro-phenyl)-3-hydroxy-1,3-dihydro-benzo[e][1,4]diazepin-2-one (lorazepam) | 7-chloro-5-(2-chlorophenyl)-3-hydroxy-1H-benzo[e][1,4]diazepin-2(3H)-one | Ativan | CHEMBL580 | LORAZEPAM | LORAZEPAM7-Chloro-5-(2-chloro-phenyl)-3-hydroxy-1,3-dihydro-benzo[e][1,4]diazepin-2-one | Loraz | Lorazepam intensol | Lorazepam preservative free | WY-4036 |
Type | Small organic molecule |
Emp. Form. | C15H10Cl2N2O2 |
Mol. Mass. | 321.158 |
SMILES | OC1N=C(c2ccccc2Cl)c2cc(Cl)ccc2NC1=O |t:2| |
Structure |
|