| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, liver |
|---|
| Ligand | BDBM22360 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_555398 (CHEMBL964795) |
|---|
| Ki | 3780000±n/a nM |
|---|
| Citation |  Chuang, S; Velkov, T; Horne, J; Porter, CJ; Scanlon, MJ Characterization of the drug binding specificity of rat liver fatty acid binding protein. J Med Chem51:3755-64 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, liver |
|---|
| Name: | Fatty acid-binding protein, liver |
|---|
| Synonyms: | FABPL_RAT | Fabp1 | Fatty acid-binding protein, liver | Liver fatty acid binding protein (rat L-FABP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14274.39 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | rat L-FABP |
|---|
| Residue: | 127 |
|---|
| Sequence: | MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIH
NEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVY
KRVSKRI
|
|
|
|---|
| BDBM22360 |
|---|
| n/a |
|---|
| Name | BDBM22360 |
|---|
| Synonyms: | 2-(acetyloxy)benzoate | 2-(acetyloxy)benzoic acid | Acetylsalicylic acid | Aspirin | Endosprin | Polopirin | Zorprin | acetylsalicylate | cid_2244 |
|---|
| Type | Anti-Inflammatory Agents, Non-Steroidal |
|---|
| Emp. Form. | C9H8O4 |
|---|
| Mol. Mass. | 180.1574 |
|---|
| SMILES | CC(=O)Oc1ccccc1C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
