Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50243174
Substrate/Competitorn/a
Meas. Tech.ChEMBL_487377
Ki 1.2±n/a nM
Citation Su DSLim JLTinney EWan BLMurphy KLReiss DRHarrell CMO'Malley SSRansom RWChang RSPettibone DJYu JTang CPrueksaritanont TFreidinger RMBock MGAnthony NJ 2-Aminobenzophenones as a novel class of bradykinin B1 receptor antagonists. J Med Chem 51:3946-52 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50243174
n/a
NameBDBM50243174
Synonyms:CHEMBL488662 | N-(2-Benzoylphenyl)-4-[({[3-(3-fluoropiperidin-1-yl)propyl]-amino}carbonyl)amino]benzenesulfonamide
TypeSmall organic molecule
Emp. Form.C28H31FN4O4S
Mol. Mass.538.634
SMILESFC1CCCN(CCCNC(=O)Nc2ccc(cc2)S(=O)(=O)Nc2ccccc2C(=O)c2ccccc2)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: