| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50274404 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_537932 (CHEMBL983517) |
|---|
| Ki | 0.3±n/a nM |
|---|
| Citation |  Denora, N; Laquintana, V; Pisu, MG; Dore, R; Murru, L; Latrofa, A; Trapani, G; Sanna, E 2-Phenyl-imidazo[1,2-a]pyridine compounds containing hydrophilic groups as potent and selective ligands for peripheral benzodiazepine receptors: synthesis, binding affinity and electrophysiological studies. J Med Chem51:6876-88 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50274404 |
|---|
| n/a |
|---|
| Name | BDBM50274404 |
|---|
| Synonyms: | CHEMBL521180 | N-Butyl-2-(6,8-dichloro-2-(4-chloro-3-nitrophenyl)imidazo[1,2-a]pyridin-3-yl)-N-methylacetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19Cl3N4O3 |
|---|
| Mol. Mass. | 469.749 |
|---|
| SMILES | CCCCN(C)C(=O)Cc1c(nc2c(Cl)cc(Cl)cn12)-c1ccc(Cl)c(c1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
