| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-7 |
|---|
| Ligand | BDBM50273583 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_560913 (CHEMBL1013548) |
|---|
| Kd | 54000±n/a nM |
|---|
| Citation |  Delaine, T; Cumpstey, I; Ingrassia, L; Le Mercier, M; Okechukwu, P; Leffler, H; Kiss, R; Nilsson, UJ Galectin-inhibitory thiodigalactoside ester derivatives have antimigratory effects in cultured lung and prostate cancer cells. J Med Chem51:8109-14 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-7 |
|---|
| Name: | Galectin-7 |
|---|
| Synonyms: | Gal-7 | HKL-14 | LEG7_HUMAN | LGALS7 | PI7 | PIG1 | p53-induced gene 1 protein |
|---|
| Type: | Galactoside-binding protein |
|---|
| Mol. Mass.: | 15077.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 136 |
|---|
| Sequence: | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF
|
|
|
|---|
| BDBM50273583 |
|---|
| n/a |
|---|
| Name | BDBM50273583 |
|---|
| Synonyms: | (2R,3R,4S,5S,6R)-4-hydroxy-6-(hydroxymethyl)-2-methoxy-5-((2S,3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)-tetrahydro-2H-pyran-2-yloxy)-tetrahydro-2H-pyran-3-yl 1-naphthoate | CHEMBL457430 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30O12 |
|---|
| Mol. Mass. | 510.4878 |
|---|
| SMILES | CO[C@@H]1O[C@H](CO)[C@@H](O[C@@H]2O[C@H](CO)[C@H](O)[C@H](O)[C@H]2O)[C@H](O)[C@H]1OC(=O)c1cccc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
