| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM24560 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_561223 (CHEMBL1012769) |
|---|
| IC50 | 12000±n/a nM |
|---|
| Citation |  Koeberle, A; Zettl, H; Greiner, C; Wurglics, M; Schubert-Zsilavecz, M; Werz, O Pirinixic acid derivatives as novel dual inhibitors of microsomal prostaglandin E2 synthase-1 and 5-lipoxygenase. J Med Chem51:8068-76 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM24560 |
|---|
| n/a |
|---|
| Name | BDBM24560 |
|---|
| Synonyms: | 2-({4-chloro-6-[(2,3-dimethylphenyl)amino]pyrimidin-2-yl}sulfanyl)octanoic acid | CHEMBL518038 | Pirinixic acid-based compound, 6a |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H26ClN3O2S |
|---|
| Mol. Mass. | 407.957 |
|---|
| SMILES | CCCCCCC(Sc1nc(Cl)cc(Nc2cccc(C)c2C)n1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
