Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGALR1
LigandBDBM50273354
Substrate/Competitorn/a
Meas. Tech.ChEMBL_561974
Ki 1.9±n/a nM
Citation Bulaj GGreen BRLee HKRobertson CRWhite KZhang LSochanska MFlynn SPScholl EAPruess THSmith MDWhite HS Design, synthesis, and characterization of high-affinity, systemically-active galanin analogues with potent anticonvulsant activities. J Med Chem 51:8038-47 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GALR1
Name:GALR1
Synonyms:GAL1-R | Galanin R1 | Galanin receptor 1 | Galanin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38976.60
Organism:Homo sapiens (Human)
Description:Galanin R1 GALR1 HUMAN::P47211
Residue:349
Sequence:
MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR
SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML
VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR
ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA
SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50273354
n/a
NameBDBM50273354
Synonyms:(S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S)-2-((S)-2-((2S,3R)-2-((S)-3-(1H-indol-3-yl)-2-(2-(methylamino)acetamido)propanamido)-3-hydroxybutanamido)-4-methylpentanamido)-4-amino-4-oxobutanamido)-3-hydroxypropanamido)propanamido)acetamido)-3-(4-hydroxyphenyl)propanamido)-4-methylpentanamido)-4-methylpentanamido)acetyl)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-6-amino-1-((S)-1-amino-1-oxo-6-palmitamidohexan-2-ylamino)-1-oxohexan-2-ylamino)-1-oxohexan-2-ylamino)-1-oxohexan-2-yl)pyrrolidine-2-ca | CHEMBL525755
TypeSmall organic molecule
Emp. Form.C104H174N24O22
Mol. Mass.2112.642
SMILESCCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: