| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galanin receptor type 1 |
|---|
| Ligand | BDBM50273355 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_561974 (CHEMBL1010037) |
|---|
| Ki | 3.5±n/a nM |
|---|
| Citation |  Bulaj, G; Green, BR; Lee, HK; Robertson, CR; White, K; Zhang, L; Sochanska, M; Flynn, SP; Scholl, EA; Pruess, TH; Smith, MD; White, HS Design, synthesis, and characterization of high-affinity, systemically-active galanin analogues with potent anticonvulsant activities. J Med Chem51:8038-47 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galanin receptor type 1 |
|---|
| Name: | Galanin receptor type 1 |
|---|
| Synonyms: | GAL1-R | GALNR | GALNR1 | GALR1 | GALR1_HUMAN | Galanin R1 | Galanin receptor 1 | Galanin receptor type 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38976.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Galanin R1 GALR1 HUMAN::P47211 |
|---|
| Residue: | 349 |
|---|
| Sequence: | MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR
SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML
VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR
ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA
SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV
|
|
|
|---|
| BDBM50273355 |
|---|
| n/a |
|---|
| Name | BDBM50273355 |
|---|
| Synonyms: | CHEMBL525023 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C104H174N24O22 |
|---|
| Mol. Mass. | 2112.642 |
|---|
| SMILES | CCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
