| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50254563 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_558752 (CHEMBL1019881) |
|---|
| Ki | 1.2±n/a nM |
|---|
| Citation |  Wentland, MP; Lou, R; Lu, Q; Bu, Y; VanAlstine, MA; Cohen, DJ; Bidlack, JM Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. Bioorg Med Chem Lett19:203-8 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50254563 |
|---|
| n/a |
|---|
| Name | BDBM50254563 |
|---|
| Synonyms: | 3-Cyclopropylmethyl-6-ethyl-11-methyl-1-oxo-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine-8-carboxylic acid amide | CHEMBL461229 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H26N2O2 |
|---|
| Mol. Mass. | 326.4326 |
|---|
| SMILES | CCC12CCN(CC3CC3)C(C1C)C(=O)c1ccc(cc21)C(N)=O |TLB:14:13:11:5.4.3,6:5:11:15.20.13,THB:19:20:11:5.4.3| |
|---|
| Structure | 
|
|---|
Search and Browse
