| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50265684 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_559545 (CHEMBL1019848) |
|---|
| EC50 | 71.6±n/a nM |
|---|
| Citation |  Diaz, P; Phatak, SS; Xu, J; Astruc-Diaz, F; Cavasotto, CN; Naguib, M 6-Methoxy-N-alkyl isatin acylhydrazone derivatives as a novel series of potent selective cannabinoid receptor 2 inverse agonists: design, synthesis, and binding mode prediction. J Med Chem52:433-44 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50265684 |
|---|
| n/a |
|---|
| Name | BDBM50265684 |
|---|
| Synonyms: | CHEMBL496371 | N'-[(3Z)-1-(Cyclohexylmethyl)-6-methoxy-2-oxo-1,2-dihydro-3H-indol-3-ylidene]cyclohexanecarbohydrazide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H31N3O3 |
|---|
| Mol. Mass. | 397.5105 |
|---|
| SMILES | COc1ccc2C(=NNC(=O)C3CCCCC3)C(=O)N(CC3CCCCC3)c2c1 |w:7.7| |
|---|
| Structure | 
|
|---|
Search and Browse
