| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50253483 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_511514 (CHEMBL980957) |
|---|
| Ki | 0.23±n/a nM |
|---|
| Citation |  Da Settimo, F; Simorini, F; Taliani, S; La Motta, C; Marini, AM; Salerno, S; Bellandi, M; Novellino, E; Greco, G; Cosimelli, B; Da Pozzo, E; Costa, B; Simola, N; Morelli, M; Martini, C Anxiolytic-like effects of N,N-dialkyl-2-phenylindol-3-ylglyoxylamides by modulation of translocator protein promoting neurosteroid biosynthesis. J Med Chem51:5798-806 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50253483 |
|---|
| n/a |
|---|
| Name | BDBM50253483 |
|---|
| Synonyms: | CHEMBL492686 | N,N-dihexyl-2-(2-(4-nitrophenyl)-1H-indol-3-yl)-2-oxoacetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H35N3O4 |
|---|
| Mol. Mass. | 477.5952 |
|---|
| SMILES | CCCCCCN(CCCCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(cc1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
