| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50252876 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_534601 (CHEMBL989026) |
|---|
| Ki | 1.8±n/a nM |
|---|
| Citation |  Le Bourdonnec, B; Windh, RT; Ajello, CW; Leister, LK; Gu, M; Chu, GH; Tuthill, PA; Barker, WM; Koblish, M; Wiant, DD; Graczyk, TM; Belanger, S; Cassel, JA; Feschenko, MS; Brogdon, BL; Smith, SA; Christ, DD; Derelanko, MJ; Kutz, S; Little, PJ; DeHaven, RN; DeHaven-Hudkins, DL; Dolle, RE Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-piperidine]-4-yl)benzamide (ADL5859). J Med Chem51:5893-6 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50252876 |
|---|
| n/a |
|---|
| Name | BDBM50252876 |
|---|
| Synonyms: | CHEMBL494462 | N,N-Diethyl-4-(spiro[chromene-2,4'-piperidine]-4-yl)benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H28N2O2 |
|---|
| Mol. Mass. | 376.4913 |
|---|
| SMILES | CCN(CC)C(=O)c1ccc(cc1)C1=CC2(CCNCC2)Oc2ccccc12 |t:14| |
|---|
| Structure | 
|
|---|
Search and Browse
