Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-tyrosine phosphatase 1B
LigandBDBM50104694
Substrate/Competitorn/a
Meas. Tech.ChEMBL_495918
IC50 4700±n/a nM
Citation Cui LThuong PTLee HSNdinteh DTMbafor JTFomum ZTOh WK Flavanones from the stem bark of Erythrina abyssinica. Bioorg Med Chem 16:10356-62 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-tyrosine phosphatase 1B
Name:Protein-tyrosine phosphatase 1B
Synonyms:PTP1B | Protein tyrosine phosphatase 1B (PTP1B) | Protein tyrosine phosphatase-1B (PTP1B) | Protein-tyrosine phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase non-receptor type 1 | Tyrosine-protein phosphatase non-receptor type 1 (PTP1B)
Type:Protein phosphatase
Mol. Mass.:49963.76
Organism:Homo sapiens (Human)
Description:Human recombinant GST-fusion PTP1B (1-435).
Residue:435
Sequence:
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104694
n/a
NameBDBM50104694
Synonyms:(R)-4-hydroxy-5-(hydroxymethyl)-3-palmitoylfuran-2(5H)-one | (R)-5-Ethyl-3-hexadecanoyl-4-methyl-5H-furan-2-oneo | 3-Hexadecanoyl-4-hydroxy-5-hydroxymethyl-5H-furan-2-one | CHEMBL108441 | RK-682
TypeSmall organic molecule
Emp. Form.C21H36O5
Mol. Mass.368.5075
SMILESCCCCCCCCCCCCCCCC(=O)c1c(O)oc(CO)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: